product
Explore Our Research Products
Discover our selection of high-quality research products developed for laboratory and analytical applications. We focus on consistent quality, reliable documentation, and dependable service so researchers can order with confidence.
OUR PRODUCTS
In Stock
5-Amino-1MQ 50mg
Enzyme Interaction and Metabolic Biochemistry Research Chemical Information: Chemical Name: 5-Amino-1-methylquinolinium iodide Molecular Formula: C₁₀H₁₁IN₂ Molecular Weight: Approximately 286.11 g/mol Compound Class:…
In Stock
ACE-031 1mg
Protein Signaling, Ligand Interaction, and Molecular Biology Research Chemical Information: Scientific Designation: ACE-031 Compound Type: Recombinant fusion protein research material Structural Class:…
In Stock
AHK-CU 100mg
Copper-Peptide, Metal Coordination, and Cellular Signaling Research Chemical Information: Sequence: Ala-His-Lys Compound Type: Synthetic copper-coordinated tripeptide research compound Molecular Formula: Verify against…
In Stock
AHk-CU GHK-CU Hair Growth Serum 30ml
Dual Copper Peptide Scalp Care for Fuller, Healthier-Looking Hair Struggling with thinning hair or weak roots? This advanced serum combines two well-researched…
In Stock
AICAR 50mg
AMPK-Activating Nucleoside Research Compound | Laboratory Use Only AICAR is a cell-permeable adenosine analog that is taken up by cells and converted…
In Stock
AOD9604 10mg
Peptide Fragment and Molecular Interaction Research Chemical Information: Molecular Formula: C₇₈H₁₂₃N₂₃O₂₃S₂ Molecular Weight: Approximately 1815.1 g/mol Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe Structural Note: AOD-9604 is…
In Stock
ARA-290 10mg
Synthetic EPO-Derived Undecapeptide | Laboratory Use Only ARA-290 (INN: cibinetide) is a synthetic 11-amino-acid peptide whose sequence corresponds to the helix B…
In Stock
B-12 10ml
High-Purity Cobalamin Research Material | Laboratory Use Only This B12 preparation is supplied as a research-grade cobalamin solution for laboratory use. Methylcobalamin…
In Stock
BAC Water 10 ML
BAC Water is a preserved aqueous laboratory solution formulated with purified or sterile water and a bacteriostatic preservative, commonly benzyl alcohol. Unlike…
In Stock
BPC157/TB500 20mg
Peptide Interaction, Structural Characterization, and Cellular Research Chemical Information: BPC-157 Molecular Formula: C₆₂H₉₈N₁₆O₂₂ BPC-157 Molecular Weight: Approximately 1419.54 g/mol TB-500 Molecular Formula:…
In Stock
Cartalax 20mg
Synthetic Tripeptide Bioregulator | Laboratory Use Only Cartalax (also referenced as AED or T-31) is a synthetic tripeptide (Ala-Glu-Asp) from the Khavinson…
In Stock
Cerebolysin 60mg
Porcine Brain-Derived Peptide Mixture | Laboratory Use Only This heterogeneous preparation is produced by enzymatic hydrolysis of purified porcine brain proteins. It…
In Stock
CJC + IPA (No DAC) 20mg
Peptide Receptor and Molecular Signaling Research Chemical Information: CJC-1295 (No DAC) Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂ CJC-1295 (No DAC) Molecular Weight: Approximately 3367.9 g/mol…
In Stock
CJC/IPA 5/5 NO DAC
In Stock
Dihexa 10mg
Angiotensin IV-Derived Oligopeptide | Laboratory Use Only Dihexa (also known as PNB-0408 or N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide) is a synthetic oligopeptide derived from angiotensin…
In Stock
DSIP 10mg
Neuropeptide, Peptide Signaling, and Molecular Interaction Research Chemical Information: Molecular Formula: C₃₅H₄₈N₁₀O₁₅ Molecular Weight: Approximately 848.81 g/mol Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu Compound Type: Synthetic…
In Stock
Eloralintide 10mg
In Stock
Epithalon 10mg
Tetrapeptide, Cellular Signaling, and Molecular Research Chemical Information: Molecular Formula: C₁₄H₂₂N₄O₉ Molecular Weight: Approximately 390.35 g/mol Sequence: Ala-Glu-Asp-Gly Compound Type: Synthetic tetrapeptide…
In Stock
EPO 3000iu
Glycoprotein Cytokine Reference Material | Laboratory Use Only Erythropoietin (EPO) is a 165-amino-acid glycoprotein hormone that regulates red blood cell development. It…
In Stock
Follistatin 1mg
Activin and Myostatin-Binding Research Protein | Laboratory Use Only Follistatin 344 is a research reagent corresponding to a 344-amino-acid human follistatin isoform.…
In Stock
GHK-CU 100mg
Copper-Peptide, Metal Coordination, and Cellular Signaling Research Chemical Information: Molecular Formula: C₁₄H₂₂CuN₆O₄ Molecular Weight: Approximately 401.95 g/mol Sequence: Gly-His-Lys Compound Type: Synthetic…
In Stock
GHK-CU SNAP-8 Serum 30ml
Advanced Copper Peptide Care for Smoother, Firmer, More Radiant-Looking Skin This lightweight serum pairs two popular skincare peptides: GHK-Cu (copper peptide) and…
In Stock
GHK-CU Tallow Honey Balm 2oz
Copper Peptide + Grass-Fed Tallow + Manuka Honey: Rich Nourishment for Face and Body This whipped balm combines GHK-Cu copper peptide with…
In Stock
GLOW 70mg
Multi-Peptide, Molecular Interaction, and Cellular Research Chemical Information: Product Designation: GLOW Compound Type: Multi-component synthetic peptide research blend Molecular Formula: Not applicable…
In Stock
GLP2-TR 10mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₅H₃₄₈N₄₈O₆₈ Molecular Weight: 4813.45 g/mol Sequence: Tyr-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-Aib-Leu-Asp-Lys-Ile-Ala-Gln-Lys-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Structural Note: Tirzepatide is a modified…
In Stock
GLP2-TR 30mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₅H₃₄₈N₄₈O₆₈ Molecular Weight: 4813.45 g/mol Sequence: Tyr-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-Aib-Leu-Asp-Lys-Ile-Ala-Gln-Lys-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Structural Note: Tirzepatide is a modified…
In Stock
GLP2-TR 60mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₅H₃₄₈N₄₈O₆₈ Molecular Weight: 4813.45 g/mol Sequence: Tyr-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-Aib-Leu-Asp-Lys-Ile-Ala-Gln-Lys-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Structural Note: Tirzepatide is a modified…
In Stock
GLP3-RT/ Cag 5/5mg
Dual-Pathway Metabolic Signaling Research Blend | Laboratory Use Only This co-formulated research blend pairs retatrutide, a synthetic peptide studied as a triple…
In Stock
GLP3-RT 10mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈ Molecular Weight: 4731.33 g/mol Sequence: YA1QGTFTSDYSIL2LDKK4AQA1AFIEYLLEGGPSSGAPPPS3 Notation Key: 1, 2, 3, and…
In Stock
GLP3-RT 15mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈ Molecular Weight: 4731.33 g/mol Sequence: YA1QGTFTSDYSIL2LDKK4AQA1AFIEYLLEGGPSSGAPPPS3 Notation Key: 1, 2, 3, and…
In Stock
GLP3-RT 20mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈ Molecular Weight: 4731.33 g/mol Sequence: YA1QGTFTSDYSIL2LDKK4AQA1AFIEYLLEGGPSSGAPPPS3 Notation Key: 1, 2, 3, and…
In Stock
GLP3-RT 30mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈ Molecular Weight: 4731.33 g/mol Sequence: YA1QGTFTSDYSIL2LDKK4AQA1AFIEYLLEGGPSSGAPPPS3 Notation Key: 1, 2, 3, and…
In Stock
GLP3-RT 40mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈ Molecular Weight: 4731.33 g/mol Sequence: YA1QGTFTSDYSIL2LDKK4AQA1AFIEYLLEGGPSSGAPPPS3 Notation Key: 1, 2, 3, and…
In Stock
GLP3-RT 50mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈ Molecular Weight: 4731.33 g/mol Sequence: YA1QGTFTSDYSIL2LDKK4AQA1AFIEYLLEGGPSSGAPPPS3 Notation Key: 1, 2, 3, and…
In Stock
GLP3-RT 60mg
Metabolic and Receptor Interaction Research Chemical Information: Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈ Molecular Weight: 4731.33 g/mol Sequence: YA1QGTFTSDYSIL2LDKK4AQA1AFIEYLLEGGPSSGAPPPS3 Notation Key: 1, 2, 3, and…
In Stock
Glutathione 1500mg
Redox Biochemistry, Peptide Chemistry, and Cellular Research Chemical Information: Molecular Formula: C₁₀H₁₇N₃O₆S Molecular Weight: Approximately 307.32 g/mol Chemical Name: γ-L-Glutamyl-L-cysteinylglycine Compound Type:…
In Stock
HCG 5,000 IU
Glycoprotein Hormone, Receptor Interaction, and Biochemical Research Chemical Information: Scientific Name: Human Chorionic Gonadotropin (hCG) Product Strength: 5000 IU Compound Type: Glycoprotein…
In Stock
HCG 10,000 IU
Glycoprotein Hormone, Receptor Interaction, and Biochemical Research Chemical Information: Scientific Name: Human Chorionic Gonadotropin (hCG) Product Strength: 5000 IU Compound Type: Glycoprotein…
In Stock
Healthy hair blend 10ml
Multi-Component B-Vitamin and Lipotropic Research Formulation | Laboratory Use Only Healthy Hair Blend (HHB) is a multi-component research formulation that combines B-vitamins…
In Stock
IGF-1 LR3 1mg
Growth Factor, Receptor Interaction, and Cellular Signaling Research Chemical Information: Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ Molecular Weight: Approximately 9111 Da Compound Type: Synthetic long-acting…
In Stock
IGF DES 1mg
Truncated IGF-1 Analog for Growth Factor Signaling Research | Laboratory Use Only IGF-1 DES (des(1-3)IGF-1) is a truncated variant of insulin-like growth…
In Stock
Ipamorelin 10mg
Peptide Receptor and Molecular Signaling Research Chemical Information: Molecular Formula: C₃₈H₄₉N₉O₅ Molecular Weight: Approximately 711.85 g/mol Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂ Structural Note: Ipamorelin is…
In Stock
Kisspeptin 10mg
Neuropeptide, Receptor Interaction, and Molecular Signaling Research Chemical Information: Common Research Form: Kisspeptin-10 Molecular Formula: C₆₃H₈₃N₁₇O₁₄ Molecular Weight: Approximately 1302.45 g/mol Sequence:…
In Stock
KLOW 80mg
Multi-Peptide, Molecular Interaction, and Cellular Research Chemical Information: Product Designation: KLOW Compound Type: Multi-component synthetic peptide research blend Molecular Formula: Not applicable…
In Stock
KPV 10mg
Peptide Signaling, Molecular Interaction, and Cellular Research Chemical Information: Molecular Formula: C₁₆H₃₀N₄O₄ Molecular Weight: Approximately 342.44 g/mol Sequence: Lys-Pro-Val Compound Type: Synthetic…
In Stock
L-Carnitine 1200mg 10ml
High-Purity Amino Acid Derivative for Metabolic Research | Laboratory Use Only L-Carnitine is a naturally occurring amino acid derivative that plays a…
In Stock
Livagen 20mg
Synthetic Tetrapeptide Bioregulator | Laboratory Use Only Livagen is a synthetic tetrapeptide (Lys-Glu-Asp-Ala, also written KEDA) from the Khavinson family of short-peptide…
In Stock
LL-37 10mg
Antimicrobial Peptide, Membrane Interaction, and Cellular Research Chemical Information: Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃ Molecular Weight: Approximately 4493.3 g/mol Sequence: [LL-37, 37 aa] Compound Type: Synthetic…
In Stock
MOTS-C 10mg
Mitochondrial Peptide and Cellular Biochemistry Research Chemical Information: Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂ Molecular Weight: Approximately 2174.62 g/mol Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg Structural Note: MOTS-C is…
In Stock
MOTS-C 40mg
Mitochondrial Peptide and Cellular Biochemistry Research Chemical Information: Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂ Molecular Weight: Approximately 2174.62 g/mol Sequence: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg Structural Note: MOTS-C is…
In Stock
MT2 10mg
Melanocortin Receptor, Cyclic Peptide, and Molecular Signaling Research Chemical Information: Scientific Name: Melanotan II Common Research Designation: MT2 Molecular Formula: C₅₀H₆₉N₁₅O₉ Molecular…
In Stock
NAD+ 500mg
Cellular Biochemistry, Redox Chemistry, and Enzyme Cofactor Research Chemical Information: Molecular Formula: C₂₁H₂₇N₇O₁₄P₂ Molecular Weight: Approximately 663.43 g/mol Chemical Name: Nicotinamide Adenine…
In Stock
NAD+ 1000mg
Cellular Biochemistry, Redox Chemistry, and Enzyme Cofactor Research Chemical Information: Molecular Formula: C₂₁H₂₇N₇O₁₄P₂ Molecular Weight: Approximately 663.43 g/mol Chemical Name: Nicotinamide Adenine…
In Stock
Oxytocin 5mg
Cyclic Nonapeptide Neuropeptide Reference Material | Laboratory Use Only Oxytocin is a nine-amino-acid cyclic neuropeptide synthesized in the hypothalamus. It acts through…
In Stock
PDRN Pink Collagen Mask (4PK)
Color-Changing Jelly Mask for Plump, Firm, Glass-Glow Skin Give your skin an at-home spa treatment with this PDRN Pink Collagen Gel Mask.…
In Stock
Pinealon 20mg
Synthetic Tripeptide Bioregulator | Laboratory Use Only Pinealon (also written EDR) is a synthetic tripeptide (Glu-Asp-Arg) from the Khavinson family of short-peptide…
In Stock
PT-141 10mg
Melanocortin Receptor and Molecular Signaling Research Chemical Information: Molecular Formula: C₅₀H₆₈N₁₄O₁₀ Molecular Weight: Approximately 1025.18 g/mol Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH Compound Type: Synthetic cyclic…
In Stock
Selank 10mg
Neuropeptide and Receptor Interaction Research Chemical Information: Molecular Formula: C₃₃H₅₇N₉O₉ Molecular Weight: 751.88 g/mol Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro Structural Note: Selank is a synthetic…
In Stock
Semax + Selank 20mg
Neuropeptide, Molecular Signaling, and Cellular Research Chemical Information: Semax Molecular Formula: C₃₇H₅₁N₉O₁₀ Semax Molecular Weight: Approximately 813.93 g/mol Semax Sequence: Met-Glu-His-Phe-Pro-Gly-Pro Selank…
In Stock
Semax 10mg
Synthetic ACTH(4-10) Analog Heptapeptide | Laboratory Use Only Semax is a synthetic heptapeptide (Met-Glu-His-Phe-Pro-Gly-Pro) derived from a fragment of adrenocorticotropic hormone (ACTH…
In Stock
SLU-PP-332 5mg
Synthetic Pan-ERR Agonist Small Molecule | Laboratory Use Only SLU-PP-332 is a synthetic small molecule developed as a pharmacological tool for studying…
In Stock
SLU-PP-332 10mg
Synthetic Pan-ERR Agonist Small Molecule | Laboratory Use Only SLU-PP-332 is a synthetic small molecule developed as a pharmacological tool for studying…
In Stock
SNAP-08 10mg
Synthetic Peptide, Protein Interaction, and Molecular Signaling Research Chemical Information: Molecular Formula: C₄₁H₇₀N₁₆O₁₆S Molecular Weight: Approximately 1075.2 g/mol Sequence: Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH₂ Compound Type:…
In Stock
SS-31 10mg
Mitochondria-Targeted Synthetic Tetrapeptide | Laboratory Use Only SS-31 (also called elamipretide) is a synthetic tetrapeptide from the Szeto-Schiller peptide family. Researchers study…
In Stock
SS-31 50mg
Mitochondria-Targeted Synthetic Tetrapeptide | Laboratory Use Only SS-31 (also called elamipretide) is a synthetic tetrapeptide from the Szeto-Schiller peptide family. Researchers study…
In Stock
Super human 10ml
Multi-Amino Acid Research Formulation | Laboratory Use Only Super Human Blend is a proprietary multi-component amino acid formulation supplied for laboratory research.…
In Stock
Super Shred 10ml
Metabolic Support Formula for Active, Weight-Conscious Lifestyles Super Shred is a targeted blend of lipotropic nutrients, combining methionine, inositol, choline, and vitamin…
In Stock
Tesamorelin 10mg
Peptide Receptor and Molecular Signaling Research Chemical Information: Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S Molecular Weight: Approximately 5135.9 g/mol Sequence: Trans-3-hexenoyl-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂ Structural Note: Tesamorelin is…
In Stock
Tesamorelin 20mg
Peptide Receptor and Molecular Signaling Research Chemical Information: Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S Molecular Weight: Approximately 5135.9 g/mol Sequence: Trans-3-hexenoyl-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂ Structural Note: Tesamorelin is…
In Stock
Testagen 10mg
Synthetic Tetrapeptide Bioregulator | Laboratory Use Only Testagen is a synthetic tetrapeptide (Lys-Glu-Asp-Gly, written KEDG) from the Khavinson family of short-peptide bioregulators,…
In Stock
Thymosin Alpha-1 5mg
Peptide Signaling, Protein Interaction, and Cellular Research Chemical Information: Molecular Formula: C₁₂₉H₂₁₅N₃₃O₅₅ Molecular Weight: Approximately 3108.3 g/mol Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn Compound Type: Synthetic…
In Stock
Vesugen 20mg
Synthetic Tripeptide Bioregulator | Laboratory Use Only Vesugen is a synthetic tripeptide (Lys-Glu-Asp, also written KED) from the Khavinson family of short-peptide…
In Stock
VIP 10mg
Neuropeptide, Receptor Interaction, and Cellular Signaling Research Chemical Information: Molecular Formula: C₁₄₇H₂₃₈N₄₄O₄₂S Molecular Weight: Approximately 3325.85 g/mol Sequence: His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ Compound Type: Synthetic…
